Protein Molecular Weight Calculator
Protein Molecular Weight Calculator computes the weight of a protein sequence, with an amino acid composition plot.
Formulas Used in Protein Molecular Weight Calculator
The calculator computes the molecular weight of a protein sequence:
Molecular Weight:
\\[ MW = \sum (\text{MW}_{\text{amino acid}}) – (n-1) \times 18.015 \\]Where:
- \\(\text{MW}_{\text{amino acid}}\\): Molecular weight of each amino acid (Da)
- \\(n\\): Number of amino acids in the sequence
- 18.015: Molecular weight of water (Da) lost per peptide bond
- \\(MW\\): Total molecular weight (Da)
Example Calculation
Example: Insulin B Chain (FVNQHLCGSHLVEALYLVCGERGFFYTPKT, 30 residues)
\\[
MW = \sum (\text{MW}_{\text{amino acids}}) – (30-1) \times 18.015 \approx 3494.65 \, \text{Da} \approx 3.49 \, \text{kDa}
\\]
Related Calculators
- Normality Calculator
- Molarity Calculator
- Mole Fraction Calculator
- Mass Percent Calculator
- Percent Composition Calculator
- Related Chemistry Calculators