google.com, pub-8308647970737773, DIRECT, f08c47fec0942fa0

Protein Molecular Weight Calculator

Protein Molecular Weight Calculator computes the weight of a protein sequence, with an amino acid composition plot.

Formulas Used in Protein Molecular Weight Calculator

The calculator computes the molecular weight of a protein sequence:

Molecular Weight:

\\[ MW = \sum (\text{MW}_{\text{amino acid}}) – (n-1) \times 18.015 \\]

Where:

  • \\(\text{MW}_{\text{amino acid}}\\): Molecular weight of each amino acid (Da)
  • \\(n\\): Number of amino acids in the sequence
  • 18.015: Molecular weight of water (Da) lost per peptide bond
  • \\(MW\\): Total molecular weight (Da)

Example Calculation

Example: Insulin B Chain (FVNQHLCGSHLVEALYLVCGERGFFYTPKT, 30 residues)

\\[ MW = \sum (\text{MW}_{\text{amino acids}}) – (30-1) \times 18.015 \approx 3494.65 \, \text{Da} \approx 3.49 \, \text{kDa} \\]

Related Calculators

  1. Normality Calculator
  2. Molarity Calculator
  3. Mole Fraction Calculator
  4. Mass Percent Calculator
  5. Percent Composition Calculator
  6. Related Chemistry Calculators